Doodle

1,830 Coloring Pages of Pollinator

plantsflowerspollinator-friendlyperennialgardensanimalswildflowertropicalinsectsmeadow
Black Orchid from Orchid
Rhododendron Calendulaceum or Flame Azalea from Azalea
Anethum graveolens or Dill from Herb
Common Buttercup Flower from Buttercup
Hemerocallis Spp or Day Lily from Perennial
Ipomoea Tuberosa Hawaiian Woodrose from Roses
Orchids from Orchid
Caterpillar and Buttefly from Caterpillar
Europeana Floribunda Rose from Roses
Flower Poppy from Red
Butterfly from Cartoon animals viii coloring book
Annual Hibiscus (Abelmoschus Moschatus) from Hawaii flower
Cosmos Scabiosoides from Cosmos
Swallow Tail Hummingbird from Hummingbirds
Apple Blossom Branch from Apple tree
Bumblebee from Woodland animals
Daffodil from Daffodil
Bee from Cartoon animals v coloring book
Steampunk Bee from Steampunk animals coloring book
Fireweed or Rosebay Willowherb from Celebrating wildflowers coloring book
Epigaea Repens or Mayflower or Trailing Arbutus from Leaves
Orchid Lycaste Aromatica from Orchid
Pollinators of Alaska from Nps
Iris Motif from Iris
Delphinium Trolliifolium or Columbian Larkspur from Larkspur
Disa Kewensis Orchid from Orchid
Chrysanthemum 1 from Perennial
Black Elderberry from Elderberry
Iris Flower Blossom from Iris
Double Delight Hybrid Tea Rose from Roses
Common Fruit Bats from Realistic animals coloring book
Bee from Cartoon animals viii coloring book
Chinese Peony from Flowers
Bug from Animals
Hibiscus Flower from Hawaii flower
Heliconia Indica from Heliconia
Cherokee Rose from Roses
Butterfly from Cartoon animals vii coloring book
Hibiscus from Realistic flowers
Spring Crocus from Crocus
Black Raspberry from Celebrating wildflowers coloring book
Butterfly from Cartoon animals coloring book
Ladybug from Cartoon animals coloring book
American Twinflower from Celebrating wildflowers coloring book
Realistic Ruby Throated Hummingbird from Hummingbirds
Ladybug from Cartoon animals v coloring book
Realistic Sunflowers from Sunflower
Daisy from Simple objects iv coloring book
Bumblebee from Simple objects coloring book
Ladybug from Cartoon animals viii coloring book
Bumblebee from Bumblebee
Saskatoon from Serviceberry
Masdevallia Coccinea Orchid from Orchid
Grasshopper on the Flower from Grasshoppers
Renanthera Imschootiana Orchid from Orchid
Hyacinth Flower from Hyacinthus
Rabbit Smelling Tulip from Grass
Hummingbird from Cartoon animals ii coloring book
Schlumbergera Bloom from Cactus
Cirsium Vulgare or Bull Thistle from Thistle
Aquilegia Truncata Red Columbine from Columbine
Dianthus Caryophyllus Clove Pink Carnation from Carnation
Cochlospermum Vitifolium or Buttercup Tree from Buttercup
Clarkia Amoena Farewell to Spring from Godetia
Oriental poppy from Perennial
Viola Adunca or Pale Mountain Violet from Violet
Daffodil Flowers from Daffodil
Tall Mountain Bluebells from Celebrating wildflowers coloring book
Bluebell Bellflower from Bellflower
Chinese Bellflower (Platycodon Grandiflorus) from Bellflower
Heliconia Psittacorum from Heliconia
Aster or Star Plant from Asters
Scarlet Carnation from Carnation
Burke's Larkspur from Celebrating wildflowers coloring book
Cute Butterfly Flies over the Swamp from Cute butterflies coloring book
Cornflower, Blue Bottle from Cornflowers
Ranunculus Acris from Buttercup
Butterfly Flies On A Flower from Flowers
Wildflower from Plants ii coloring book
Bug from Cartoon animals coloring book
Tropical Vanda Tricolor Orchid from Orchid
Grasshopper on Flower from Grasshoppers
ʻIʻiwi - Hawaiian Honeycreeper from Hawaii
Grasshopper in Garden from Grasshoppers
Sophronitis Cernua Orchid from Orchid
Common Evening Primrose or Evening Star from Primrose
Sundowner Rosa Grandiflora from Roses
Cornflower from Cornflowers
Aster 1 from Asters
Black Locust from Locust tree
Giant Red Indian Paintbrush from Celebrating wildflowers coloring book
Big-Headed Clover from Celebrating wildflowers coloring book
Life Cycle of Monarch Butterfly from Biology
Hiker's Gentian Or Explorer's Gentian from Celebrating wildflowers coloring book
Pink Hibiscus from Realistic flowers
Yellow Edged Giant Owl Butterfly from Butterfly
Chrysanthemum Morifolium from Flower garden
Anemone Coronaria from Anemone
Daffodil from Daffodil
Chrysanthemum Carinatum from Realistic flowers
201 - 300 of 1,830 Next page
/ 19